Materials Map

Discover the materials research landscape. Find experts, partners, networks.

  • About
  • Privacy Policy
  • Legal Notice
  • Contact

The Materials Map is an open tool for improving networking and interdisciplinary exchange within materials research. It enables cross-database search for cooperation and network partners and discovering of the research landscape.

The dashboard provides detailed information about the selected scientist, e.g. publications. The dashboard can be filtered and shows the relationship to co-authors in different diagrams. In addition, a link is provided to find contact information.

×

Materials Map under construction

The Materials Map is still under development. In its current state, it is only based on one single data source and, thus, incomplete and contains duplicates. We are working on incorporating new open data sources like ORCID to improve the quality and the timeliness of our data. We will update Materials Map as soon as possible and kindly ask for your patience.

To Graph

1.080 Topics available

To Map

977 Locations available

693.932 PEOPLE
693.932 People People

693.932 People

Show results for 693.932 people that are selected by your search filters.

←

Page 1 of 27758

→
←

Page 1 of 0

→
PeopleLocationsStatistics
Naji, M.
  • 2
  • 13
  • 3
  • 2025
Motta, Antonella
  • 8
  • 52
  • 159
  • 2025
Aletan, Dirar
  • 1
  • 1
  • 0
  • 2025
Mohamed, Tarek
  • 1
  • 7
  • 2
  • 2025
Ertürk, Emre
  • 2
  • 3
  • 0
  • 2025
Taccardi, Nicola
  • 9
  • 81
  • 75
  • 2025
Kononenko, Denys
  • 1
  • 8
  • 2
  • 2025
Petrov, R. H.Madrid
  • 46
  • 125
  • 1k
  • 2025
Alshaaer, MazenBrussels
  • 17
  • 31
  • 172
  • 2025
Bih, L.
  • 15
  • 44
  • 145
  • 2025
Casati, R.
  • 31
  • 86
  • 661
  • 2025
Muller, Hermance
  • 1
  • 11
  • 0
  • 2025
Kočí, JanPrague
  • 28
  • 34
  • 209
  • 2025
Šuljagić, Marija
  • 10
  • 33
  • 43
  • 2025
Kalteremidou, Kalliopi-ArtemiBrussels
  • 14
  • 22
  • 158
  • 2025
Azam, Siraj
  • 1
  • 3
  • 2
  • 2025
Ospanova, Alyiya
  • 1
  • 6
  • 0
  • 2025
Blanpain, Bart
  • 568
  • 653
  • 13k
  • 2025
Ali, M. A.
  • 7
  • 75
  • 187
  • 2025
Popa, V.
  • 5
  • 12
  • 45
  • 2025
Rančić, M.
  • 2
  • 13
  • 0
  • 2025
Ollier, Nadège
  • 28
  • 75
  • 239
  • 2025
Azevedo, Nuno Monteiro
  • 4
  • 8
  • 25
  • 2025
Landes, Michael
  • 1
  • 9
  • 2
  • 2025
Rignanese, Gian-Marco
  • 15
  • 98
  • 805
  • 2025

Feist, Florian

  • Google
  • 14
  • 65
  • 247

Karlsruhe Institute of Technology

in Cooperation with on an Cooperation-Score of 37%

Topics

Publications (14/14 displayed)

  • 2024Functionally Gradient Macroporous Polymers: Emulsion Templating Offers Control over Density, Pore Morphology, and Composition7citations
  • 2023Deconstructing 3D Structured Materials by Modern Ultramicrotomy for Multimodal Imaging and Volume Analysis across Length Scales6citations
  • 2023Deconstructing 3D Structured Materials by Modern Ultramicrotomy for Multimodal Imaging and Volume Analysis across Length Scalescitations
  • 2023Laser printed microelectronics56citations
  • 2023Direct Visualization of Homogeneous Chemical Distribution in Functional Polyradical Microspheres8citations
  • 2023Characterisation of thermally treated beech and birch by means of quasi-static tests and ultrasonic waves6citations
  • 2021A Comparative Study on the Temperature Effect of Solid Birch Wood and Solid Beech Wood under Impact Loading15citations
  • 2021Zerstörungsfreie Charakterisierung von Furnieren für strukturelle Verbundwerkstoffecitations
  • 2021Predicting strength of Finnish birch veneers based on three different failure criteria10citations
  • 2020Temperature related properties of solid birch wood under quasi-static and dynamic bending18citations
  • 2019GVTR: A Generic Vehicle Test Rig Representative Of The Contemporary European Vehicle Fleetcitations
  • 2019Development Of A Certification Procedure For Numerical Pedestrian Modelscitations
  • 2016Coding and decoding libraries of sequence-defined functional copolymers synthesized via photoligation121citations
  • 2016Methodology for kinematic comparison of human body models for pedestrian simulationscitations

Places of action

Chart of shared publication
Wagner, Markus
1 / 8 shared
Bismarck, Alexander
1 / 142 shared
Tang, Le
1 / 2 shared
Baumann, Georg
6 / 6 shared
Jiang, Qixiang
1 / 15 shared
Xu, Yufeng
1 / 1 shared
Nok-Iangthong, Chanokporn
1 / 1 shared
Hoffmann, Julian
2 / 2 shared
Weidinger, Britta
2 / 5 shared
Kammerer, Jochen A.
3 / 3 shared
Coelln, Nadine Von
1 / 3 shared
Islam, Monsur
2 / 9 shared
Blasco, Eva
3 / 21 shared
Gengenbach, Ulrich
2 / 3 shared
Curticean, Ronald
2 / 2 shared
Huck, Christian
2 / 5 shared
Schmitt, Tanja
2 / 3 shared
Wegener, Martin
3 / 33 shared
Barner-Kowollik, Christopher
2 / 11 shared
Huang, Li-Yu
2 / 2 shared
Schröder, Rasmus R.
3 / 7 shared
Tegeder, Petra
2 / 11 shared
Ryklin, Daniel
3 / 4 shared
Mayer, Frederik
2 / 4 shared
Wacker, Irene
2 / 5 shared
Von Coelln, Nadine
1 / 2 shared
Yang, Liang
1 / 3 shared
Marques, Gabriel Cadilha
1 / 3 shared
Scholz, Alexander
1 / 2 shared
Bojanowski, Niklas Maximilian
1 / 1 shared
Kraus, Steven
1 / 1 shared
Hu, Hongrong
1 / 2 shared
Aghassi-Hagmann, Jasmin
1 / 8 shared
Sarkar, Abhishek
1 / 6 shared
Stadlmann, Alexander
5 / 8 shared
Al-Musawi, Hajir
1 / 3 shared
Ungerer, Bernhard
1 / 4 shared
Müller, Ulrich
5 / 29 shared
Lahayne, Olaf
1 / 1 shared
Vand, Mojtaba Hassan
1 / 1 shared
Manni, Elisa
1 / 1 shared
Nobile, Riccardo
1 / 10 shared
Brandner, Reinhard
2 / 5 shared
Pramreiter, Maximilian
2 / 3 shared
Konnerth, Johannes
1 / 12 shared
Bodner, Sabine C.
2 / 11 shared
Keckes, Jozef
2 / 41 shared
Huber, Christian
1 / 7 shared
Maawad, Emad
1 / 59 shared
Kumpenza, Cedou
1 / 3 shared
Dornbusch, Florian
1 / 1 shared
Roth, Franz
1 / 1 shared
Besch, Alexander
1 / 1 shared
Schinke, Stefan
1 / 1 shared
Sharma, Nisha Nandlal
1 / 1 shared
Klug, Corina
3 / 4 shared
Ratingen, Michiel Van
2 / 2 shared
Ellway, James
1 / 1 shared
Schneider, Bernd
1 / 1 shared
Sinz, Wolfgang
2 / 2 shared
Zydziak, Nicolas
1 / 5 shared
Konrad, Waldemar
1 / 1 shared
Weidner, Steffen
1 / 16 shared
Afonin, Sergii
1 / 2 shared
Raffler, Marco
1 / 1 shared
Chart of publication period
2024
2023
2021
2020
2019
2016

Co-Authors (by relevance)

  • Wagner, Markus
  • Bismarck, Alexander
  • Tang, Le
  • Baumann, Georg
  • Jiang, Qixiang
  • Xu, Yufeng
  • Nok-Iangthong, Chanokporn
  • Hoffmann, Julian
  • Weidinger, Britta
  • Kammerer, Jochen A.
  • Coelln, Nadine Von
  • Islam, Monsur
  • Blasco, Eva
  • Gengenbach, Ulrich
  • Curticean, Ronald
  • Huck, Christian
  • Schmitt, Tanja
  • Wegener, Martin
  • Barner-Kowollik, Christopher
  • Huang, Li-Yu
  • Schröder, Rasmus R.
  • Tegeder, Petra
  • Ryklin, Daniel
  • Mayer, Frederik
  • Wacker, Irene
  • Von Coelln, Nadine
  • Yang, Liang
  • Marques, Gabriel Cadilha
  • Scholz, Alexander
  • Bojanowski, Niklas Maximilian
  • Kraus, Steven
  • Hu, Hongrong
  • Aghassi-Hagmann, Jasmin
  • Sarkar, Abhishek
  • Stadlmann, Alexander
  • Al-Musawi, Hajir
  • Ungerer, Bernhard
  • Müller, Ulrich
  • Lahayne, Olaf
  • Vand, Mojtaba Hassan
  • Manni, Elisa
  • Nobile, Riccardo
  • Brandner, Reinhard
  • Pramreiter, Maximilian
  • Konnerth, Johannes
  • Bodner, Sabine C.
  • Keckes, Jozef
  • Huber, Christian
  • Maawad, Emad
  • Kumpenza, Cedou
  • Dornbusch, Florian
  • Roth, Franz
  • Besch, Alexander
  • Schinke, Stefan
  • Sharma, Nisha Nandlal
  • Klug, Corina
  • Ratingen, Michiel Van
  • Ellway, James
  • Schneider, Bernd
  • Sinz, Wolfgang
  • Zydziak, Nicolas
  • Konrad, Waldemar
  • Weidner, Steffen
  • Afonin, Sergii
  • Raffler, Marco
OrganizationsLocationPeople

document

Development Of A Certification Procedure For Numerical Pedestrian Models

  • Ratingen, Michiel Van
  • Ellway, James
  • Schneider, Bernd
  • Sinz, Wolfgang
  • Feist, Florian
  • Klug, Corina
Abstract

IntheEuroNCAPtestingofdeployablepedestrianprotectionsystems(i.e.activebonnetsandairbags),headimpacttime(HIT),wraparounddistanceandbonnetdeflectionduetobodyloadingareassessedbymeansofsimulationswithnumericalpedestrianmodels.Theaimofthisstudywastodefinerequirementsfornumericalpedestrianmodelsandsimulationsetupstoensurecomparableperformanceofmodelsandsimulationresults.These requirements were summarized in a certification procedure which focuses on the pedestrian’s kinematics that are important for the Euro NCAP assessment. Twelve different institutions (academia and industry) applied aharmonisedpedestriansimulationprotocol,whichwasestablishedwithinapreviousstudy.Numericalpedestrianmodelsinthestatureofthe50thpercentilemale(allapplicablefortheassessmentofdeployablesystemsuntil2017)wereimpactedwithfourdifferentlyshapedgenericvehiclemodelsatthreedifferentcollision speeds according to the protocol. Trajectories, contact forces and HITs were evaluated. Finally, 18 full datasetsincludingthe12loadcaseswereavailablecoveringdifferentHumanBodyModelsandHumanoidMultibodyModelsinfourdifferentFEcodes.Referencevalues,corridorsandtolerancesforthecertificationprocedurewerederived,basedonidentifiedconsistentresults.Comparablebehaviourwasobservedforthemajorityofpedestrianmodels.However,asmallnumberofsimulationsshowedclearlyoutlyingbehaviourintermsofHITs,trajectoriesandcontactforces.Theconsistentmodelswerewithinarangeof+3.5%and-7%throughoutallloadcases.Corridorsforthez-andx-trajectoriesasafunctionoftimeweredevelopedforthehead centre of gravity, T12 and the centre of acetabuli for each load case. Furthermore, corridors for the contact forcesbetweenpedestrianmodelandgenericvehiclemodelwereestablished.Thedevelopedcertificationprocedureensuresthataspecificpedestrianmodelwithinaspecificenvironment,solverversionandspecificsimulationsettingsgivescomparablekinematicresultsrelevantfortheassessmentofdeployablesystems.Inconsistentpedestrianmodels,incompatibilitieswithcontrolsettingsandusererrorscanbeidentifiedandsorted out. The procedure was implemented in the Euro NCAP Technical Bulletin 24 and has been in force since January 2018.

Topics