People | Locations | Statistics |
---|---|---|
Naji, M. |
| |
Motta, Antonella |
| |
Aletan, Dirar |
| |
Mohamed, Tarek |
| |
Ertürk, Emre |
| |
Taccardi, Nicola |
| |
Kononenko, Denys |
| |
Petrov, R. H. | Madrid |
|
Alshaaer, Mazen | Brussels |
|
Bih, L. |
| |
Casati, R. |
| |
Muller, Hermance |
| |
Kočí, Jan | Prague |
|
Šuljagić, Marija |
| |
Kalteremidou, Kalliopi-Artemi | Brussels |
|
Azam, Siraj |
| |
Ospanova, Alyiya |
| |
Blanpain, Bart |
| |
Ali, M. A. |
| |
Popa, V. |
| |
Rančić, M. |
| |
Ollier, Nadège |
| |
Azevedo, Nuno Monteiro |
| |
Landes, Michael |
| |
Rignanese, Gian-Marco |
|
Feist, Florian
Karlsruhe Institute of Technology
in Cooperation with on an Cooperation-Score of 37%
Topics
Publications (14/14 displayed)
- 2024Functionally Gradient Macroporous Polymers: Emulsion Templating Offers Control over Density, Pore Morphology, and Compositioncitations
- 2023Deconstructing 3D Structured Materials by Modern Ultramicrotomy for Multimodal Imaging and Volume Analysis across Length Scalescitations
- 2023Deconstructing 3D Structured Materials by Modern Ultramicrotomy for Multimodal Imaging and Volume Analysis across Length Scales
- 2023Laser printed microelectronicscitations
- 2023Direct Visualization of Homogeneous Chemical Distribution in Functional Polyradical Microspherescitations
- 2023Characterisation of thermally treated beech and birch by means of quasi-static tests and ultrasonic wavescitations
- 2021A Comparative Study on the Temperature Effect of Solid Birch Wood and Solid Beech Wood under Impact Loadingcitations
- 2021Zerstörungsfreie Charakterisierung von Furnieren für strukturelle Verbundwerkstoffe
- 2021Predicting strength of Finnish birch veneers based on three different failure criteriacitations
- 2020Temperature related properties of solid birch wood under quasi-static and dynamic bendingcitations
- 2019GVTR: A Generic Vehicle Test Rig Representative Of The Contemporary European Vehicle Fleet
- 2019Development Of A Certification Procedure For Numerical Pedestrian Models
- 2016Coding and decoding libraries of sequence-defined functional copolymers synthesized via photoligationcitations
- 2016Methodology for kinematic comparison of human body models for pedestrian simulations
Places of action
Organizations | Location | People |
---|
document
Development Of A Certification Procedure For Numerical Pedestrian Models
Abstract
IntheEuroNCAPtestingofdeployablepedestrianprotectionsystems(i.e.activebonnetsandairbags),headimpacttime(HIT),wraparounddistanceandbonnetdeflectionduetobodyloadingareassessedbymeansofsimulationswithnumericalpedestrianmodels.Theaimofthisstudywastodefinerequirementsfornumericalpedestrianmodelsandsimulationsetupstoensurecomparableperformanceofmodelsandsimulationresults.These requirements were summarized in a certification procedure which focuses on the pedestrian’s kinematics that are important for the Euro NCAP assessment. Twelve different institutions (academia and industry) applied aharmonisedpedestriansimulationprotocol,whichwasestablishedwithinapreviousstudy.Numericalpedestrianmodelsinthestatureofthe50thpercentilemale(allapplicablefortheassessmentofdeployablesystemsuntil2017)wereimpactedwithfourdifferentlyshapedgenericvehiclemodelsatthreedifferentcollision speeds according to the protocol. Trajectories, contact forces and HITs were evaluated. Finally, 18 full datasetsincludingthe12loadcaseswereavailablecoveringdifferentHumanBodyModelsandHumanoidMultibodyModelsinfourdifferentFEcodes.Referencevalues,corridorsandtolerancesforthecertificationprocedurewerederived,basedonidentifiedconsistentresults.Comparablebehaviourwasobservedforthemajorityofpedestrianmodels.However,asmallnumberofsimulationsshowedclearlyoutlyingbehaviourintermsofHITs,trajectoriesandcontactforces.Theconsistentmodelswerewithinarangeof+3.5%and-7%throughoutallloadcases.Corridorsforthez-andx-trajectoriesasafunctionoftimeweredevelopedforthehead centre of gravity, T12 and the centre of acetabuli for each load case. Furthermore, corridors for the contact forcesbetweenpedestrianmodelandgenericvehiclemodelwereestablished.Thedevelopedcertificationprocedureensuresthataspecificpedestrianmodelwithinaspecificenvironment,solverversionandspecificsimulationsettingsgivescomparablekinematicresultsrelevantfortheassessmentofdeployablesystems.Inconsistentpedestrianmodels,incompatibilitieswithcontrolsettingsandusererrorscanbeidentifiedandsorted out. The procedure was implemented in the Euro NCAP Technical Bulletin 24 and has been in force since January 2018.