| People | Locations | Statistics |
|---|---|---|
| Naji, M. |
| |
| Motta, Antonella |
| |
| Aletan, Dirar |
| |
| Mohamed, Tarek |
| |
| Ertürk, Emre |
| |
| Taccardi, Nicola |
| |
| Kononenko, Denys |
| |
| Petrov, R. H. | Madrid |
|
| Alshaaer, Mazen | Brussels |
|
| Bih, L. |
| |
| Casati, R. |
| |
| Muller, Hermance |
| |
| Kočí, Jan | Prague |
|
| Šuljagić, Marija |
| |
| Kalteremidou, Kalliopi-Artemi | Brussels |
|
| Azam, Siraj |
| |
| Ospanova, Alyiya |
| |
| Blanpain, Bart |
| |
| Ali, M. A. |
| |
| Popa, V. |
| |
| Rančić, M. |
| |
| Ollier, Nadège |
| |
| Azevedo, Nuno Monteiro |
| |
| Landes, Michael |
| |
| Rignanese, Gian-Marco |
|
Kafarski, M.
in Cooperation with on an Cooperation-Score of 37%
Topics
Publications (17/17 displayed)
- 2021Application of a dagger probe for soil dielectric permittivity measurement by TDRcitations
- 2020Application of a Monopole Antenna Probe with an Optimized Flange Diameter for TDR Soil Moisture Measurementcitations
- 2020Time domain transmission sensor for soil moisture profile probe, selected technical aspects citations
- 2020Evaluation of a Multi-Rod Probe Performance for Accurate Measurements of Soil Water Contentcitations
- 2020Dielectric Properties of Glass Beads with Talc as a Reference Material for Calibration and Verification of Dielectric Methods and Devices for Measuring Soil Moisturecitations
- 2020Wideband Characterization of Soil Complex Dielectric Permittivity Spectrum
- 2019Impact of soil salinity, texture and measurement frequency on the relations between soil moisture and 20 MHz–3 GHz dielectric permittivity spectrum for soils of medium texturecitations
- 2019An open-ended probe with an antenna for the measurement of the water content in the soilcitations
- 2019One-Port Vector Network Analyzer Characterization of Soil Dielectric Spectrumcitations
- 2019Verification of soil salinity index model based on 0.02–3 GHz complex dielectric permittivity spectrum measurementscitations
- 2019Seven-Rod Dielectric Sensor for Determination of Soil Moisture in Small Volumes
- 2019A Seven-Rod Dielectric Sensor for Determination of Soil Moisture in Well-Defined Sample Volumescitations
- 2018The Calibration-Free Method for Determining Dielectric Permittivity Spectrum
- 2018Electromagnetic multi-simulation method for determining dielectric permittivity spectrum
- 2018Impact of soil salinity on the relation between soil moisture and dielectric permittivitycitations
- 2018The Effect of Storage Time on Dielectric Properties of Pasteurized Milks and Yoghurtcitations
- 2017Soil salinity characterization based on 0.05-3 GHz dielectric permittivity measurementscitations
Places of action
| Organizations | Location | People |
|---|
booksection
The Effect of Storage Time on Dielectric Properties of Pasteurized Milks and Yoghurt
Abstract
The aim of the study was to investigate the effect of storagetimeoncomplexdielectricpermittivityofopenedmilkwithdifferentfatcontentandofanaturalyoghurt.Themeasurementswereconductedusingavectornetworkanalyzerandanopen-endedcoaxial-lineprobeinthefrequencyrangefrom 200 MHz to 20 GHz at 9±0.5°C. The results showed that the realpartofdielectricpermittivityofthetestedproductsdecreasedwithanincreaseoffrequency,whiletheimaginarypartofdielectricpermittivityincreasedbelow14.3GHzforyoghurtand13.6GHzformilksanddecreasedabovethosefrequencies.Duringstoragetherealpartofdielectricpermittivity of yoghurt and milks slightly decreased. The value of theimaginarypartofdielectricpermittivityvariedmuchmorefor milks during time storage. The changes of the imaginary part ofdielectricpermittivityofthetestedproductswereassociatedwiththechangesofpHvalue.Finally,complexdielectricpermittivity spectra of the measured products were modeled with thetwo-poleandthree-poleDebyemodel.Three-poleDebyefunction was better fitting to the results.