People | Locations | Statistics |
---|---|---|
Naji, M. |
| |
Motta, Antonella |
| |
Aletan, Dirar |
| |
Mohamed, Tarek |
| |
Ertürk, Emre |
| |
Taccardi, Nicola |
| |
Kononenko, Denys |
| |
Petrov, R. H. | Madrid |
|
Alshaaer, Mazen | Brussels |
|
Bih, L. |
| |
Casati, R. |
| |
Muller, Hermance |
| |
Kočí, Jan | Prague |
|
Šuljagić, Marija |
| |
Kalteremidou, Kalliopi-Artemi | Brussels |
|
Azam, Siraj |
| |
Ospanova, Alyiya |
| |
Blanpain, Bart |
| |
Ali, M. A. |
| |
Popa, V. |
| |
Rančić, M. |
| |
Ollier, Nadège |
| |
Azevedo, Nuno Monteiro |
| |
Landes, Michael |
| |
Rignanese, Gian-Marco |
|
Lewandowski, Arkadiusz
in Cooperation with on an Cooperation-Score of 37%
Topics
Publications (24/24 displayed)
- 2021Application of a dagger probe for soil dielectric permittivity measurement by TDRcitations
- 2020Application of a Monopole Antenna Probe with an Optimized Flange Diameter for TDR Soil Moisture Measurementcitations
- 2020Time domain transmission sensor for soil moisture profile probe, selected technical aspects citations
- 2020Evaluation of a Multi-Rod Probe Performance for Accurate Measurements of Soil Water Contentcitations
- 2020Dielectric Properties of Glass Beads with Talc as a Reference Material for Calibration and Verification of Dielectric Methods and Devices for Measuring Soil Moisturecitations
- 2020Wideband Characterization of Soil Complex Dielectric Permittivity Spectrum
- 2019Impact of soil salinity, texture and measurement frequency on the relations between soil moisture and 20 MHz–3 GHz dielectric permittivity spectrum for soils of medium texturecitations
- 2019An open-ended probe with an antenna for the measurement of the water content in the soilcitations
- 2019One-Port Vector Network Analyzer Characterization of Soil Dielectric Spectrumcitations
- 2019Verification of soil salinity index model based on 0.02–3 GHz complex dielectric permittivity spectrum measurementscitations
- 2019Seven-Rod Dielectric Sensor for Determination of Soil Moisture in Small Volumes
- 2019A Seven-Rod Dielectric Sensor for Determination of Soil Moisture in Well-Defined Sample Volumescitations
- 2018The Calibration-Free Method for Determining Dielectric Permittivity Spectrum
- 2018Electromagnetic multi-simulation method for determining dielectric permittivity spectrum
- 2018Impact of soil salinity on the relation between soil moisture and dielectric permittivitycitations
- 2018The Effect of Storage Time on Dielectric Properties of Pasteurized Milks and Yoghurtcitations
- 2018Comparison between coaxial transmission line methods by measurement of porous clay samples of varying moisture contentcitations
- 2017Salinity index determination of porous materials using open-ended probescitations
- 2017Soil salinity characterization based on 0.05-3 GHz dielectric permittivity measurementscitations
- 2017Wideband extraction of soil dielectric spectrum from vector-network-analyzer measurementscitations
- 20170.05–3 GHz VNA characterization of soil dielectric properties based on the multiline TRL calibrationcitations
- 2016Challenges in packaging of IR detectors – technology of elastic electrical connectionscitations
- 2015Challenges in packaging of IR detectors – technology of elastic electrical connections
- 2014Broadband Dielectric Spectroscopy Calibration Using Calibration Liquids with Unknown Permittivitycitations
Places of action
Organizations | Location | People |
---|
booksection
The Effect of Storage Time on Dielectric Properties of Pasteurized Milks and Yoghurt
Abstract
The aim of the study was to investigate the effect of storagetimeoncomplexdielectricpermittivityofopenedmilkwithdifferentfatcontentandofanaturalyoghurt.Themeasurementswereconductedusingavectornetworkanalyzerandanopen-endedcoaxial-lineprobeinthefrequencyrangefrom 200 MHz to 20 GHz at 9±0.5°C. The results showed that the realpartofdielectricpermittivityofthetestedproductsdecreasedwithanincreaseoffrequency,whiletheimaginarypartofdielectricpermittivityincreasedbelow14.3GHzforyoghurtand13.6GHzformilksanddecreasedabovethosefrequencies.Duringstoragetherealpartofdielectricpermittivity of yoghurt and milks slightly decreased. The value of theimaginarypartofdielectricpermittivityvariedmuchmorefor milks during time storage. The changes of the imaginary part ofdielectricpermittivityofthetestedproductswereassociatedwiththechangesofpHvalue.Finally,complexdielectricpermittivity spectra of the measured products were modeled with thetwo-poleandthree-poleDebyemodel.Three-poleDebyefunction was better fitting to the results.